PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00224g00514.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family NAC
Protein Properties Length: 314aa    MW: 36231.3 Da    PI: 10.3735
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00224g00514.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM942.3e-2957853127
                       NAM  53 aeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyr 127
                               ++++ew+fFs+r +ky++g++++rat+sgyWkatgk+++v+s +++ +g+k+tLvf++grapkg++t+W+mhey 
  Peaxi162Scf00224g00514.1   5 ESDNEWFFFSPRGRKYPNGSQSKRATESGYWKATGKERNVKS-GSNMIGTKRTLVFHTGRAPKGQRTQWIMHEYC 78 
                               5689**************************************.99*****************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100536.125197IPR003441NAC domain
SuperFamilySSF1019418.37E-34596IPR003441NAC domain
PfamPF023653.4E-14977IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
KSIVESDNEW FFFSPRGRKY PNGSQSKRAT ESGYWKATGK ERNVKSGSNM IGTKRTLVFH  60
TGRAPKGQRT QWIMHEYCKT GNSYVEDSMV VCRLRKNNEF HLNDTPGSRR NHPATTETKE  120
GISSFSSHLV EKIESESGSE SDKLTKELSH HHSSSFWKDF DEEDCFADIM KDDIIKLDDS  180
SYKARNNNLL PIITRKLESP TTSSTWEAQN VMSHRLPFQG TANRRLRLQK ERAPRRVERS  240
EAVEANKKKN HAVSISRRFI DIKPVKMMKH WLIPLFLVSL MLLVIFLCLF GVPQQVKWLR  300
HLVITPAEVN IKPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-2569672167NAC domain-containing protein 19
3swm_B2e-2569672167NAC domain-containing protein 19
3swm_C2e-2569672167NAC domain-containing protein 19
3swm_D2e-2569672167NAC domain-containing protein 19
3swp_A2e-2569672167NAC domain-containing protein 19
3swp_B2e-2569672167NAC domain-containing protein 19
3swp_C2e-2569672167NAC domain-containing protein 19
3swp_D2e-2569672167NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009787917.11e-165PREDICTED: NAC domain-containing protein 89-like
TrEMBLM1BQC91e-151M1BQC9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000504821e-146(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41542243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22290.11e-51NAC domain containing protein 89